General Information

  • ID:  hor005662
  • Uniprot ID:  Q9I8P3
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  npy
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  NPY Family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding; GO:0031843 type 2 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0071878 negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway; GO:2000253 positive regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SSADTLISDLLIGETESRPQTRYEDHLAW
  • Length:  29(68-96)
  • Propeptide:  MNPNMKMWMSWAACAFLLFVCLGTLTEGYPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRYGKRSSADTLISDLLIGETESRPQTRYEDHLAW
  • Signal peptide:  MNPNMKMWMSWAACAFLLFVCLGTLTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9I8P3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005662_AF2.pdbhor005662_ESM.pdb

Physical Information

Mass: 380419 Formula: C143H223N39O51
Absent amino acids: CFKMNV Common amino acids: LS
pI: 4.07 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -63.45 Boman Index: -7167
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 87.59
Instability Index: 4023.45 Extinction Coefficient cystines: 6990
Absorbance 280nm: 249.64

Literature

  • PubMed ID:  10936170
  • Title:  Zebrafish Genes for Neuropeptide Y and Peptide YY Reveal Origin by Chromosome Duplication From an Ancestral Gene Linked to the Homeobox Cluster